For Research Use Only — Not for human or veterinary use.

Wellness & Longevity

GLP-1

Metabolic signaling research peptide

01 — Overview

Glucagon-like peptide-1 analog studied for its role in glucose homeostasis and appetite-regulating pathways.

02 — Mechanism in research literature

Published research investigates GLP-1 receptor agonism and its downstream effects on insulin secretion, gastric emptying, and central satiety signaling.

03 — Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

04 — Research areas

  • Glucose metabolism
  • Satiety pathways
  • Receptor signaling

06 — Related

Continue exploring.